PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23794s0703.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 387aa    MW: 42698.9 Da    PI: 8.7798
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23794s0703.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.5e-1853113257
                           T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                           ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  Bostr.23794s0703.1.p  53 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 113
                           89*****************99*************************************995 PP

2Wus_type_Homeobox112.32.5e-3652114264
     Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                           +++RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
  Bostr.23794s0703.1.p  52 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 114
                           689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.68949114IPR001356Homeobox domain
SuperFamilySSF466893.68E-1250117IPR009057Homeodomain-like
SMARTSM003891.2E-851118IPR001356Homeobox domain
CDDcd000861.23E-852114No hitNo description
PfamPF000469.0E-1653113IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-653112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHPHQ WQHDINSPLL PSASHRSSPF SSGCEVERSP EPKPRWNPKP  60
EQIRILEAIF NSGMVNPPRE EIRRIRAQLQ EYGQVGDANV FYWFQNRKSR SKHKLRLLHN  120
HSKHSLPQPQ PQPQHQPLSS ANSASSSSSS SSSSSSSKST KPRKNKNKNN TNLSLGGSQM  180
MGMFPPEAAF VFPVSTVGGF EGITVSSQVG FLSGDMIEQQ KPAPTLGPCT GLLLSEIMNG  240
SVSYGTHHQQ HLSEKEDEEM RIKMLQQPQP QICYATTSQQ ITSYNNNDNI MLHVPPTTST  300
TTTTITTSHS LATVPSTSDL LQVQAGARIR VFINEMELEV SPGPFNVRDA FGEEVVLINS  360
AGQPIVTDDY GVALHPLQHG ASYYLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1185010.0AK118501.1 Arabidopsis thaliana At2g33880 mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL19-73-K21.
GenBankAY2514010.0AY251401.1 Arabidopsis thaliana WOX9 protein mRNA, complete cds.
GenBankBT0052960.0BT005296.1 Arabidopsis thaliana At2g33880 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010473852.10.0PREDICTED: WUSCHEL-related homeobox 9
SwissprotQ6X7J40.0WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLR0G0R00.0R0G0R0_9BRAS; Uncharacterized protein (Fragment)
STRINGAl_scaffold_0004_18720.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.10.0homeobox-3